PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_150.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 596aa    MW: 64572.4 Da    PI: 6.8633
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_150.7genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.24.7e-10432489562
                                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                                  kr++r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +  l+++
  evm.model.supercontig_150.7 432 KRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQ 489
                                  9********************************************9998877666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.2E-18428492IPR004827Basic-leucine zipper domain
PfamPF077166.5E-8429481IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.737430493IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.38E-11432483No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-10432488No hitNo description
CDDcd147038.43E-25433482No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MGDTEEGNID MMQKIQNSFG AGSSSIAKQT LSMNHQLDIP HFNPNQIRPR HFPQYSQALN  60
SGESSKRVGI PPSHPSQIPP ISPYSQIPVS RPANPQVGSQ NLSPGPSHSR SLSQPSSFFS  120
LDSLPPLSPS PFRDPHSATI PDHVSTDVSM EDRDAGGSHS LLPPSPFARS NSPRVGEALP  180
PRKAHRRSNS DIPFGFRSVM HSSPPLIPLR GSVGLERSMP GRENSGVAKP AQLVKRESSW  240
ERGSDSTAEG MGERKSEGEV VDDLFSAYMN LDNIDVLNSS GTDDKGNENR EDLDSRASGT  300
KTNGGDSSDN EAESSVNENG NSLQGQGAGM SLSTEKREGV KRSAGGDIAP TTRHYRSMSM  360
DSFMGKLNFG DESPKLPPSP GTRPGQLSPT NSIDGNSNAF SLEFGNGEFS GAELKKIMAN  420
EKLAEIALTD PKRAKRILAN RQSAARSKER KMRYISELEH KVQTLQTEAT TLSAQLTLLQ  480
RDSVGLTNQN NELKFRLQAM EQQAQLRDAL NDALTAEVRR LKLATELSGD SDQSKAMLIN  540
AQLFQMQQQQ AAQLNIHQLQ PPPQAQQPPP PPQQQQTPPP QQQNGSNTPK PESNP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007042006.10.0Basic-leucine zipper transcription factor family protein isoform 1
TrEMBLA0A061DZL60.0A0A061DZL6_THECC; Basic-leucine zipper transcription factor family protein isoform 1
STRINGPOPTR_0004s17080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-155bZIP family protein